This is a demo store. No orders will be fulfilled.
| Description | Olfactory receptor 1C1 |
|---|
Gene and Protein Information
| Gene ID | 26188 |
|---|---|
| Uniprot Accession IDs | Q15619 B9EIR9 Q5VVD2 Q6IF97 Q8NGZ1 Q96R83 |
| Ensembl ID | ENSG00000221888 |
| Symbol | OR1-42 ORL211 TPCR27 HSTPCR27 OR1.5.10 |
| Chromosome | 1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence |
MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMYFFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAYDRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCDLNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRGLQKMLLKCTVFQQQ
Show more
|
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Olfactory receptor / Olfactory receptor 1C1
protein / G-protein coupled receptor / Class A rhodopsin like / Olfactory receptor / Olfactory receptor 1C1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later