JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

P2RY13

Description	P2Y purinoceptor 13

Gene and Protein Information

Gene ID	53829
Uniprot Accession IDs	Q9BPV8 B2R827 Q05C50 Q6DKN4 Q8IUT5 Q8TDU7 Q9BY61 P2Y13
Ensembl ID	ENSG00000181631
Symbol	GPR86 GPR94 GPCR1 GPR86 GPR94 P2Y13 SP174 FKSG77
Chromosome	3
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	738859	P2RY13	purinergic receptor P2Y13	9598	VGNC:7992	OMA, EggNOG
Mouse	74191	P2ry13	purinergic receptor P2Y, G-protein coupled 13	10090	MGI:1921441	Inparanoid, OMA, EggNOG
Rat	310444	P2ry13	purinergic receptor P2Y13	10116	RGD:1302941	Inparanoid, OMA, EggNOG
Dog	102155830	P2RY13	purinergic receptor P2Y13	9615	VGNC:44215	Inparanoid, OMA, EggNOG
Horse	100050217	P2RY13	purinergic receptor P2Y13	9796	VGNC:21111	Inparanoid, OMA, EggNOG
Cow	782774	P2RY13	purinergic receptor P2Y13	9913	VGNC:32526	Inparanoid, OMA, EggNOG
Opossum	103104547	P2RY13	purinergic receptor P2Y13	13616		Inparanoid, OMA, EggNOG
Anole lizard	103278183	p2ry13	purinergic receptor P2Y13	28377		Inparanoid, OMA
Xenopus	548413	p2ry13	purinergic receptor P2Y, G-protein coupled, 13	8364	XB-GENE-5807786	Inparanoid, OMA

PANTHER Classes
protein / receptor / G-protein coupled receptor / P2Y purinoceptor 13

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2Y purinoceptor 13

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.