JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PTF1A

Description	Pancreas transcription factor 1 subunit alpha

Gene and Protein Information

Gene ID	256297
Uniprot Accession IDs	Q7RTS3 Q9HC25
Ensembl ID	ENSG00000168267
Symbol	BHLHA29 PTF1P48 p48 PACA PAGEN2 bHLHa29 PTF1-p48
Chromosome	10
Sequence	MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	19213	Ptf1a	pancreas specific transcription factor, 1a	10090	MGI:1328312	Inparanoid, OMA, EggNOG
Rat	117034	Ptf1a	pancreas associated transcription factor 1a	10116	RGD:621709	Inparanoid, OMA, EggNOG
Dog	608313	PTF1A	pancreas associated transcription factor 1a	9615	VGNC:52912	Inparanoid, OMA, EggNOG
Horse		PTF1A	pancreas specific transcription factor, 1a [Source:HGNC Symbol;Acc:HGNC:23734]	9796		OMA, EggNOG
Cow	781540	PTF1A	pancreas associated transcription factor 1a	9913	VGNC:33498	Inparanoid, OMA, EggNOG
Pig	100623168	PTF1A	pancreas specific transcription factor, 1a	9823		OMA, EggNOG
Opossum	100019635	PTF1A	pancreas specific transcription factor, 1a	13616		Inparanoid, OMA, EggNOG
Anole lizard	100567005	ptf1a	pancreas specific transcription factor, 1a	28377		Inparanoid, OMA, EggNOG
Xenopus	100494161	ptf1a	pancreas associated transcription factor 1a	8364	XB-GENE-484425	Inparanoid, OMA, EggNOG
Zebrafish	368662	ptf1a	pancreas associated transcription factor 1a	7955	ZDB-GENE-030616-579	Inparanoid, OMA, EggNOG
Fruitfly	2768661	Fer1	48 related 1	7227	FBgn0037475	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.