The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PLA2G2A
| Description |
Phospholipase A2, membrane associated
|
Gene and Protein Information
| Gene ID |
5320
|
| Uniprot Accession IDs |
P14555
A8K5I7
Q6DN24
Q6IBD9
Q9UCD2
|
| Ensembl ID |
ENSG00000188257
|
| Symbol |
PLA2B
PLA2L
RASF-A
MOM1
PLA2
PLA2B
PLA2L
PLA2S
PLAS1
sPLA2
|
| Chromosome |
1
|
| Family |
Belongs to the phospholipase A2 family. |
| Sequence |
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
456587 |
PLA2G2A |
phospholipase A2 group IIA |
9598 |
VGNC:9878 |
OMA, EggNOG |
| Macaque |
704520 |
PLA2G2A |
phospholipase A2 group IIA |
9544 |
|
Inparanoid, OMA, EggNOG |
| Rat |
29692 |
Pla2g2a |
phospholipase A2 group IIA |
10116 |
RGD:620857 |
Inparanoid, OMA, EggNOG |
| Horse |
100037401 |
PLA2G2A |
phospholipase A2 group IIA |
9796 |
VGNC:21508 |
OMA, EggNOG |
| Cow |
507201 |
PLA2G2A |
phospholipase A2, group IIA (platelets, synovial fluid) |
9913 |
|
OMA, EggNOG |
| Cow |
615045 |
LOC615045 |
phospholipase A2, membrane associated |
9913 |
|
Inparanoid, OMA |
| Pig |
|
PLA2G2A |
phospholipase A2 group IIA [Source:HGNC Symbol;Acc:HGNC:9031] |
9823 |
|
OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.