JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

P2RX4

Description	P2X purinoceptor 4

Gene and Protein Information

Gene ID	5025
Uniprot Accession IDs	Q99571 E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4
Ensembl ID	ENSG00000135124
Symbol	P2X4 P2X4R
Chromosome	12
Family	Belongs to the P2X receptor family.
Sequence	MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	452319	P2RX4	purinergic receptor P2X 4	9598	VGNC:8487	OMA, EggNOG
Macaque	702536	P2RX4	purinergic receptor P2X 4	9544		Inparanoid, OMA, EggNOG
Mouse	18438	P2rx4	purinergic receptor P2X, ligand-gated ion channel 4	10090	MGI:1338859	Inparanoid, OMA, EggNOG
Rat	29659	P2rx4	purinergic receptor P2X 4	10116	RGD:62073	Inparanoid, OMA, EggNOG
Dog	448783	P2RX4	purinergic receptor P2X 4	9615	VGNC:44210	Inparanoid, OMA, EggNOG
Horse	100059626	P2RX4	purinergic receptor P2X 4	9796	VGNC:50960	Inparanoid, OMA, EggNOG
Cow	338036	P2RX4	purinergic receptor P2X 4	9913	VGNC:32520	Inparanoid, OMA, EggNOG
Opossum	100618270	P2RX4	purinergic receptor P2X 4	13616		Inparanoid, OMA, EggNOG
Platypus		P2RX4	purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535]	9258		OMA, EggNOG
Chicken	374166	P2RX4	purinergic receptor P2X 4	9031	CGNC:2857	Inparanoid, OMA
Anole lizard	100561452	p2rx4	purinergic receptor P2X 4	28377		Inparanoid, OMA
Xenopus	100489363	p2rx4	purinergic receptor P2X, ligand gated ion channel, 4	8364	XB-GENE-967965	Inparanoid, OMA
Zebrafish	259258	p2rx4a	purinergic receptor P2X, ligand-gated ion channel, 4a	7955	ZDB-GENE-020806-2	Inparanoid, OMA

DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 4

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.