JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

P2RY12

Description	P2Y purinoceptor 12

Gene and Protein Information

Gene ID	64805
Uniprot Accession IDs	Q9H244 D3DNJ5 Q546J7 P2Y12
Ensembl ID	ENSG00000169313
Symbol	HORK3 HORK3 P2Y12 ADPG-R BDPLT8 SP1999 P2T(AC) P2Y(AC) P2Y(12)R P2Y(ADP) P2Y(cyc)
Chromosome	3
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	710036	P2RY12	purinergic receptor P2Y12	9544		Inparanoid, OMA, EggNOG
Mouse	70839	P2ry12	purinergic receptor P2Y, G-protein coupled 12	10090	MGI:1918089	Inparanoid, OMA, EggNOG
Rat	64803	P2ry12	purinergic receptor P2Y12	10116	RGD:621681	Inparanoid, OMA, EggNOG
Dog	442958	P2RY12	purinergic receptor P2Y12	9615	VGNC:44214	Inparanoid, OMA, EggNOG
Horse	100630046	P2RY12	purinergic receptor P2Y12	9796	VGNC:21110	Inparanoid, OMA, EggNOG
Cow	408007	P2RY12	purinergic receptor P2Y12	9913	VGNC:32525	Inparanoid, OMA, EggNOG
Pig	503659	P2RY12	purinergic receptor P2Y12	9823		OMA, EggNOG
Opossum	100618708	P2RY12	purinergic receptor P2Y12	13616		Inparanoid, OMA, EggNOG
Platypus	100682030	P2RY12	purinergic receptor P2Y12	9258		Inparanoid, OMA, EggNOG
Anole lizard	103278184	p2ry12	purinergic receptor P2Y12	28377		Inparanoid, OMA
Xenopus	100493410	p2ry12	purinergic receptor P2Y, G-protein coupled, 12	8364	XB-GENE-947453	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / receptor / G-protein coupled receptor / P2y purinoceptor 12

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2y purinoceptor 12

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.