JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GHRL

Description	Appetite-regulating hormone

Gene and Protein Information

Gene ID	51738
Uniprot Accession IDs	Q9UBU3 A8CF34 A8CF38 A8CF42 A8DN29 A8DN30 Q86YP8 Q8TAT9 Q9H3R3
Ensembl ID	ENSG00000157017
Symbol	MTLRP MTLRP
Chromosome	3
Family	Belongs to the motilin family.
Sequence	MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100609092	GHRL	ghrelin and obestatin prepropeptide	9598	VGNC:14243	OMA, EggNOG
Macaque	574280	GHRL	ghrelin and obestatin prepropeptide	9544		Inparanoid, OMA, EggNOG
Mouse	58991	Ghrl	ghrelin	10090	MGI:1930008	Inparanoid, OMA, EggNOG
Rat	59301	Ghrl	ghrelin and obestatin prepropeptide	10116	RGD:632283	Inparanoid, OMA, EggNOG
Dog	403587	GHRL	ghrelin and obestatin prepropeptide	9615	VGNC:41209	Inparanoid, OMA, EggNOG
Horse	100058008	GHRL	ghrelin and obestatin prepropeptide	9796	VGNC:18335	Inparanoid, OMA, EggNOG
Cow	281192	GHRL	ghrelin and obestatin prepropeptide	9913	VGNC:29351	Inparanoid, OMA, EggNOG
Pig	396728	GHRL	ghrelin and obestatin prepropeptide	9823		Inparanoid, OMA, EggNOG
Opossum	100024400	GHRL	ghrelin and obestatin prepropeptide	13616		Inparanoid, OMA, EggNOG
Chicken	408185	GHRL	ghrelin/obestatin prepropeptide	9031	CGNC:6373	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.