JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GALP

Description	Galanin-like peptide

Gene and Protein Information

Gene ID	85569
Uniprot Accession IDs	Q9UBC7 A1KXL3
Ensembl ID	ENSG00000197487
Chromosome	19
Family	Belongs to the galanin family.
Sequence	MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469110	GALP	galanin like peptide	9598	VGNC:2400	OMA, EggNOG
Macaque	704323	GALP	galanin like peptide	9544		Inparanoid, OMA
Mouse	232836	Galp	galanin-like peptide	10090	MGI:2663979	Inparanoid, OMA, EggNOG
Rat	64568	Galp	galanin-like peptide	10116	RGD:620187	Inparanoid, OMA, EggNOG
Dog	102151546	GALP	galanin like peptide	9615	VGNC:41099	Inparanoid, OMA, EggNOG
Horse		GALP	galanin like peptide [Source:HGNC Symbol;Acc:HGNC:24840]	9796		OMA, EggNOG
Pig	396772	GALP	galanin like peptide	9823		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.