JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FABP1

Description	Fatty acid-binding protein, liver

Gene and Protein Information

Gene ID	2168
Uniprot Accession IDs	P07148
Ensembl ID	ENSG00000163586
Symbol	FABPL FABPL L-FABP
Chromosome	2
Family	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736471	FABP1	fatty acid binding protein 1	9598	VGNC:7696	OMA, EggNOG
Mouse	14080	Fabp1	fatty acid binding protein 1, liver	10090	MGI:95479	Inparanoid, OMA, EggNOG
Rat	24360	Fabp1	fatty acid binding protein 1	10116	RGD:2590	Inparanoid, OMA, EggNOG
Dog	403619	FABP1	fatty acid binding protein 1	9615	VGNC:40558	Inparanoid, OMA, EggNOG
Horse	100052746	FABP1	fatty acid binding protein 1	9796	VGNC:17765	Inparanoid, OMA, EggNOG
Cow	327700	FABP1	fatty acid binding protein 1	9913	VGNC:28695	Inparanoid, OMA, EggNOG
Pig	445535	FABP1	fatty acid binding protein 1	9823		Inparanoid, OMA, EggNOG
Opossum		FABP1	fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]	13616		Inparanoid, EggNOG
Platypus		FABP1	fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]	9258		OMA, EggNOG
Chicken	374015	FABP1	fatty acid binding protein 1	9031	CGNC:11895	OMA, EggNOG
Anole lizard	100562032	fabp1	fatty acid binding protein 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100144636	fabp1	fatty acid binding protein 1	8364	XB-GENE-481608	Inparanoid, OMA, EggNOG
Zebrafish	791610	fabp1a	fatty acid binding protein 1a, liver	7955	ZDB-GENE-020318-3	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.