JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GNMT

Description	Glycine N-methyltransferase

Gene and Protein Information

Gene ID	27232
Uniprot Accession IDs	Q14749 Q5T8W2 Q9NNZ1 Q9NS24
Ensembl ID	ENSG00000124713
Symbol	HEL-S-182mP
Chromosome	6
Family	Belongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family.
Sequence	MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462703	GNMT	glycine N-methyltransferase	9598	VGNC:2847	OMA, EggNOG
Macaque	697722	GNMT	glycine N-methyltransferase	9544		Inparanoid, OMA, EggNOG
Mouse	14711	Gnmt	glycine N-methyltransferase	10090	MGI:1202304	Inparanoid, OMA, EggNOG
Rat	25134	Gnmt	glycine N-methyltransferase	10116	RGD:2719	OMA, EggNOG
Rat	100911564	LOC100911564	glycine N-methyltransferase-like	10116	RGD:6491825	Inparanoid, OMA
Dog	474905	GNMT	glycine N-methyltransferase	9615	VGNC:41329	Inparanoid, OMA, EggNOG
Horse	100067145	GNMT	glycine N-methyltransferase	9796	VGNC:18442	Inparanoid, OMA, EggNOG
Cow	538212	GNMT	glycine N-methyltransferase	9913	VGNC:29475	Inparanoid, OMA, EggNOG
Opossum	100010632	GNMT	glycine N-methyltransferase	13616		Inparanoid, OMA, EggNOG
Anole lizard	100552842	gnmt	glycine N-methyltransferase	28377		Inparanoid, OMA, EggNOG
Zebrafish	403338	gnmt	glycine N-methyltransferase	7955	ZDB-GENE-040227-1	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.