The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
GNMT
| Description |
Glycine N-methyltransferase
|
Gene and Protein Information
| Gene ID |
27232
|
| Uniprot Accession IDs |
Q14749
Q5T8W2
Q9NNZ1
Q9NS24
|
| Ensembl ID |
ENSG00000124713
|
| Symbol |
HEL-S-182mP
|
| Chromosome |
6
|
| Family |
Belongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family. |
| Sequence |
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
462703 |
GNMT |
glycine N-methyltransferase |
9598 |
VGNC:2847 |
OMA, EggNOG |
| Macaque |
697722 |
GNMT |
glycine N-methyltransferase |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
14711 |
Gnmt |
glycine N-methyltransferase |
10090 |
MGI:1202304 |
Inparanoid, OMA, EggNOG |
| Rat |
25134 |
Gnmt |
glycine N-methyltransferase |
10116 |
RGD:2719 |
OMA, EggNOG |
| Rat |
100911564 |
LOC100911564 |
glycine N-methyltransferase-like |
10116 |
RGD:6491825 |
Inparanoid, OMA |
| Dog |
474905 |
GNMT |
glycine N-methyltransferase |
9615 |
VGNC:41329 |
Inparanoid, OMA, EggNOG |
| Horse |
100067145 |
GNMT |
glycine N-methyltransferase |
9796 |
VGNC:18442 |
Inparanoid, OMA, EggNOG |
| Cow |
538212 |
GNMT |
glycine N-methyltransferase |
9913 |
VGNC:29475 |
Inparanoid, OMA, EggNOG |
| Opossum |
100010632 |
GNMT |
glycine N-methyltransferase |
13616 |
|
Inparanoid, OMA, EggNOG |
| Anole lizard |
100552842 |
gnmt |
glycine N-methyltransferase |
28377 |
|
Inparanoid, OMA, EggNOG |
| Zebrafish |
403338 |
gnmt |
glycine N-methyltransferase |
7955 |
ZDB-GENE-040227-1 |
Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.