JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GSTM2

Description	Glutathione S-transferase Mu 2

Gene and Protein Information

Gene ID	2946
Uniprot Accession IDs	P28161 B4DRY4 E9PEM9 Q2M318 Q5TZY5 Q8WWE1
Ensembl ID	ENSG00000213366
Symbol	GST4 GST4 GSTM GTHMUS GSTM2-2
Chromosome	1
Family	Belongs to the GST superfamily. Mu family.
Sequence	MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	68312	Gstm7	glutathione S-transferase, mu 7	10090	MGI:1915562	Inparanoid, OMA
Mouse	14863	Gstm2	glutathione S-transferase, mu 2	10090	MGI:95861	OMA, EggNOG
Horse	100058329	LOC100058329	glutathione S-transferase Mu 1-like	9796		OMA, EggNOG
Xenopus	448387	gstm1	glutathione S-transferase mu 1	8364	XB-GENE-971384	OMA, EggNOG
Zebrafish	568744	gstm.3	glutathione S-transferase mu tandem duplicate 3	7955	ZDB-GENE-050309-24	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.