JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

H1F0

Description	Histone H1.0

Gene and Protein Information

Gene ID	3005
Uniprot Accession IDs	P07305 B2R6I0 B4DRD6 Q6FG88 Q8N6R3
Ensembl ID	ENSP00000344504
Symbol	H1FV H10 H1FV
Chromosome	22
Family	Belongs to the histone H1/H5 family.
Sequence	MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743278	H1F0	H1 histone family member 0	9598	VGNC:14352	OMA, EggNOG
Mouse	14958	H1f0	H1 histone family, member 0	10090	MGI:95893	Inparanoid, OMA, EggNOG
Cow	617975	H1F0	H1 histone family, member 0	9913		Inparanoid, OMA, EggNOG
Xenopus	407939	h1f0	H1 histone family member 0	8364	XB-GENE-480028	Inparanoid, OMA, EggNOG
Zebrafish	321618	h1f0	H1 histone family, member 0	7955	ZDB-GENE-030131-337	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / nucleic acid binding / histone / Histone H1.0

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Histone / Histone H1.0

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.