This is a demo store. No orders will be fulfilled.

EPCAM

Description Epithelial cell adhesion molecule

Gene and Protein Information

Gene ID 4072
Uniprot Accession IDs P16422 P18180 Q6FG26 Q6FG49 Q96C47 Q9UCD0 Ep-CAM
Ensembl ID ENSG00000119888
Symbol GA733-2 M1S2 M4S1 MIC18 TACSTD1 TROP1 ESA KSA M4S1 MK-1 DIAR5 EGP-2 EGP40 KS1/4 MIC18 TROP1 EGP314 HNPCC8 TACSTD1
Chromosome 2
Family Belongs to the EPCAM family.
Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 459214 EPCAM epithelial cell adhesion molecule 9598 VGNC:245 OMA, EggNOG
Macaque 677680 EPCAM epithelial cell adhesion molecule 9544 Inparanoid, OMA, EggNOG
Mouse 17075 Epcam epithelial cell adhesion molecule 10090 MGI:106653 Inparanoid, OMA, EggNOG
Rat 171577 Epcam epithelial cell adhesion molecule 10116 RGD:621365 Inparanoid, OMA, EggNOG
Dog 481360 EPCAM epithelial cell adhesion molecule 9615 VGNC:54146 Inparanoid, OMA, EggNOG
Horse 100053148 EPCAM epithelial cell adhesion molecule 9796 VGNC:17614 Inparanoid, OMA, EggNOG
Cow 514039 EPCAM epithelial cell adhesion molecule 9913 VGNC:28529 Inparanoid, OMA, EggNOG
Pig 403163 EPCAM epithelial cell adhesion molecule 9823 Inparanoid, OMA, EggNOG
Opossum 100033359 EPCAM epithelial cell adhesion molecule 13616 Inparanoid, EggNOG
Chicken 421292 EPCAM epithelial cell adhesion molecule 9031 CGNC:6812 Inparanoid, OMA
Xenopus 496567 epcam epithelial cell adhesion molecule 8364 XB-GENE-986667 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.