JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

HBEGF

Description	Proheparin-binding EGF-like growth factor

Gene and Protein Information

Gene ID	1839
Uniprot Accession IDs	Q99075 B2R821
Ensembl ID	ENSG00000113070
Symbol	DTR DTS HEGFL DTR DTS DTSF HEGFL
Chromosome	5
Sequence	MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	735979	HBEGF	heparin binding EGF like growth factor	9598	VGNC:6931	OMA, EggNOG
Macaque	695559	HBEGF	heparin binding EGF like growth factor	9544		Inparanoid, OMA, EggNOG
Mouse	15200	Hbegf	heparin-binding EGF-like growth factor	10090	MGI:96070	Inparanoid, OMA, EggNOG
Rat	25433	Hbegf	heparin-binding EGF-like growth factor	10116	RGD:2526	Inparanoid, OMA, EggNOG
Dog	607007	HBEGF	heparin binding EGF like growth factor	9615	VGNC:41609	Inparanoid, OMA, EggNOG
Horse		HBEGF	heparin binding EGF like growth factor [Source:HGNC Symbol;Acc:HGNC:3059]	9796		OMA, EggNOG
Cow	522921	HBEGF	heparin binding EGF like growth factor	9913	VGNC:29765	Inparanoid, OMA, EggNOG
Pig	397564	HBEGF	heparin binding EGF like growth factor	9823		Inparanoid, OMA, EggNOG
Opossum	100026152	HBEGF	heparin binding EGF like growth factor	13616		Inparanoid, EggNOG
Chicken	395654	HBEGF	heparin binding EGF like growth factor	9031	CGNC:628	Inparanoid, OMA, EggNOG
Zebrafish	407664	hbegfb	heparin-binding EGF-like growth factor b	7955	ZDB-GENE-070820-6	Inparanoid, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Proheparin-binding EGF-like growth factor

DTO Classes
protein / Signaling / Growth factor / Proheparin-binding EGF-like growth factor

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.