This is a demo store. No orders will be fulfilled.

HIST1H1D

Description Histone H1.3

Gene and Protein Information

Gene ID 3007
Uniprot Accession IDs P16402 B2R751 Q2M2I2
Ensembl ID ENSP00000244534
Symbol H1F3 H1D H1.3 H1F3 H1s-2
Chromosome 6
Family Belongs to the histone H1/H5 family.
Sequence
MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 472227 HIST1H1D histone cluster 1 H1 family member d 9598 VGNC:14368 OMA, EggNOG
Macaque 698238 HIST1H1D histone cluster 1, H1d 9544 Inparanoid, OMA, EggNOG
Mouse 14957 Hist1h1d histone cluster 1, H1d 10090 MGI:107502 Inparanoid, EggNOG
Cow 509275 HIST1H1D histone cluster 1, H1d 9913 Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    histone    /    Histone H1.3
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Histone    /    Histone H1.3

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.