JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

EFNA4

Description	Ephrin-A4

Gene and Protein Information

Gene ID	1945
Uniprot Accession IDs	P52798 C9JHJ8 G3XAK2 O95457 Q5SR71 Q6FI57
Ensembl ID	ENSG00000243364
Symbol	EPLG4 LERK4 EFL4 EPLG4 LERK4
Chromosome	1
Family	Belongs to the ephrin family.
Sequence	MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469510	EFNA4	ephrin A4	9598	VGNC:9854	OMA, EggNOG
Macaque	717373	EFNA3	ephrin A3	9544		OMA, EggNOG
Mouse	13639	Efna4	ephrin A4	10090	MGI:106643	Inparanoid, OMA, EggNOG
Rat	310643	Efna4	ephrin A4	10116	RGD:1307808	Inparanoid, OMA, EggNOG
Dog	490433	EFNA4	ephrin A4	9615	VGNC:40227	Inparanoid, OMA, EggNOG
Horse	100063240	EFNA4	ephrin A4	9796	VGNC:17448	Inparanoid, OMA, EggNOG
Cow	615879	EFNA4	ephrin A4	9913	VGNC:28357	Inparanoid, OMA, EggNOG
Opossum	100021625	EFNA4	ephrin A4	13616		Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / membrane-bound signaling molecule / Ephrin-A4

DTO Classes
protein / Signaling / Membrane-bound signaling molecule / Ephrin-A4

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.