This is a demo store. No orders will be fulfilled.
| Description | Rab GDP dissociation inhibitor beta |
|---|
Gene and Protein Information
| Gene ID | 2665 |
|---|---|
| Uniprot Accession IDs | P50395 O43928 Q5SX88 Q9UQM6 Rab GDI beta |
| Ensembl ID | ENSG00000057608 |
| Symbol | RABGDIB RABGDIB HEL-S-46e |
| Chromosome | 10 |
| Family | Belongs to the Rab GDI family. |
| Sequence |
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450283 | GDI2 | GDP dissociation inhibitor 2 | 9598 | VGNC:3865 | OMA, EggNOG |
| Macaque | 712510 | GDI2 | GDP dissociation inhibitor 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14569 | Gdi2 | guanosine diphosphate (GDP) dissociation inhibitor 2 | 10090 | MGI:99845 | Inparanoid, OMA, EggNOG |
| Rat | 29662 | Gdi2 | GDP dissociation inhibitor 2 | 10116 | RGD:61802 | Inparanoid, OMA, EggNOG |
| Dog | 403818 | GDI2 | GDP dissociation inhibitor 2 | 9615 | VGNC:41165 | Inparanoid, OMA, EggNOG |
| Cow | 509832 | GDI2 | GDP dissociation inhibitor 2 | 9913 | VGNC:29308 | Inparanoid, OMA |
| Pig | 414427 | GDI2 | GDP dissociation inhibitor 2 | 9823 | Inparanoid, OMA | |
| Opossum | 100022775 | GDI2 | GDP dissociation inhibitor 2 | 13616 | Inparanoid, OMA | |
| Platypus | GDI2 | GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227] | 9258 | OMA, EggNOG | ||
| Chicken | 395854 | GDI2 | GDP dissociation inhibitor 2 | 9031 | CGNC:49512 | Inparanoid, OMA |
| Anole lizard | 100553642 | gdi2 | GDP dissociation inhibitor 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448175 | gdi2 | GDP dissociation inhibitor 2 | 8364 | XB-GENE-980621 | OMA, EggNOG |
| Zebrafish | 323765 | gdi2 | GDP dissociation inhibitor 2 | 7955 | ZDB-GENE-030131-2485 | Inparanoid, OMA |
| Fruitfly | 34264 | Gdi | GDP dissociation inhibitor | 7227 | FBgn0004868 | Inparanoid, EggNOG |
| S.cerevisiae | 856876 | GDI1 | Gdi1p | 4932 | S000000938 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Rab GDP dissociation inhibitor beta
protein / enzyme modulator / acyltransferase / Rab GDP dissociation inhibitor beta
protein / enzyme modulator / G-protein modulator / Rab GDP dissociation inhibitor beta
protein / enzyme modulator / acyltransferase / Rab GDP dissociation inhibitor beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later