This is a demo store. No orders will be fulfilled.
| Description | G-protein coupled bile acid receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 151306 |
|---|---|
| Uniprot Accession IDs | Q8TDU6 B3KV35 |
| Ensembl ID | ENSG00000179921 |
| Symbol | TGR5 BG37 TGR5 M-BAR GPCR19 GPR131 |
| Chromosome | 2 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence |
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741111 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9598 | VGNC:50730 | OMA, EggNOG |
| Macaque | 697937 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9544 | Inparanoid, OMA | |
| Mouse | 227289 | Gpbar1 | G protein-coupled bile acid receptor 1 | 10090 | MGI:2653863 | Inparanoid, OMA, EggNOG |
| Rat | 338443 | Gpbar1 | G protein-coupled bile acid receptor 1 | 10116 | RGD:631400 | Inparanoid, OMA |
| Horse | 100055590 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9796 | VGNC:18482 | Inparanoid, OMA, EggNOG |
| Cow | 317756 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9913 | VGNC:29521 | Inparanoid, OMA, EggNOG |
| Opossum | 100011968 | GPBAR1 | G protein-coupled bile acid receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566467 | gpbar1 | G protein-coupled bile acid receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100488432 | gpbar1 | G protein-coupled bile acid receptor 1 | 8364 | XB-GENE-959591 | Inparanoid, OMA, EggNOG |
| Zebrafish | 797190 | gpbar1 | G protein-coupled bile acid receptor 1 | 7955 | ZDB-GENE-120315-1 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later