JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ARPC2

Description	Actin-related protein 2/3 complex subunit 2

Gene and Protein Information

Gene ID	10109
Uniprot Accession IDs	O15144 Q92801 Q9P1D4
Ensembl ID	ENSG00000163466
Symbol	ARC34 ARC34 PRO2446 p34-Arc PNAS-139
Chromosome	2
Family	Belongs to the ARPC2 family.
Sequence	MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459938	ARPC2	actin related protein 2/3 complex subunit 2	9598	VGNC:90	OMA, EggNOG
Macaque	700536	ARPC2	actin related protein 2/3 complex subunit 2	9544		Inparanoid, OMA, EggNOG
Mouse	76709	Arpc2	actin related protein 2/3 complex, subunit 2	10090	MGI:1923959	Inparanoid, OMA, EggNOG
Rat	301511	Arpc2	actin related protein 2/3 complex, subunit 2	10116	RGD:1305848	Inparanoid, OMA
Horse	100058331	ARPC2	actin related protein 2/3 complex subunit 2	9796	VGNC:15537	Inparanoid, OMA, EggNOG
Cow	540838	ARPC2	actin related protein 2/3 complex subunit 2	9913		Inparanoid, OMA, EggNOG
Pig	100153175	ARPC2	actin related protein 2/3 complex subunit 2	9823		Inparanoid, OMA, EggNOG
Opossum	100011642	ARPC2	actin related protein 2/3 complex subunit 2	13616		Inparanoid, OMA, EggNOG
Chicken	429041	ARPC2	actin related protein 2/3 complex subunit 2	9031		Inparanoid, OMA, EggNOG
Anole lizard	100566658	arpc2	actin related protein 2/3 complex subunit 2	28377		Inparanoid, OMA, EggNOG
Xenopus	448094	arpc2	actin related protein 2/3 complex subunit 2	8364	XB-GENE-491571	Inparanoid, OMA, EggNOG
Zebrafish	327068	arpc2	actin related protein 2/3 complex, subunit 2	7955	ZDB-GENE-030131-5276	Inparanoid, OMA, EggNOG
C. elegans	175247	arx-4	Probable actin-related protein 2/3 complex subunit 2	6239		Inparanoid, OMA
Fruitfly	35311	Arpc2	Actin-related protein 2/3 complex, subunit 2	7227	FBgn0032859	Inparanoid, EggNOG
S.cerevisiae	855771	ARC35	Arc35p	4932	S000005318	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.