JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ATE1

Description	Arginyl-tRNA--protein transferase 1

Gene and Protein Information

Gene ID	11101
Uniprot Accession IDs	O95260 O95261 Q5SQQ3 Q8WW04 Arginyltransferase 1
Ensembl ID	ENSG00000107669
Chromosome	10
Family	Belongs to the R-transferase family.
Sequence	MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQMVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	450786	ATE1	arginyltransferase 1	9598	VGNC:51966	OMA, EggNOG
Macaque	705248	ATE1	arginyltransferase 1	9544		Inparanoid, OMA, EggNOG
Mouse	11907	Ate1	arginyltransferase 1	10090	MGI:1333870	Inparanoid, OMA, EggNOG
Rat	293526	Ate1	arginyltransferase 1	10116	RGD:1309335	Inparanoid, OMA, EggNOG
Dog	486919	ATE1	arginyltransferase 1	9615	VGNC:38206	Inparanoid, OMA, EggNOG
Horse	100064881	ATE1	arginyltransferase 1	9796	VGNC:15608	Inparanoid, OMA, EggNOG
Cow	534601	ATE1	arginyltransferase 1	9913	VGNC:26238	Inparanoid, OMA, EggNOG
Pig	100512816	ATE1	arginyltransferase 1	9823		Inparanoid, OMA, EggNOG
Opossum	100025687	ATE1	arginyltransferase 1	13616		Inparanoid, EggNOG
Chicken	423936	ATE1	arginyltransferase 1	9031	CGNC:7230	Inparanoid, OMA, EggNOG
Anole lizard	100562215	ate1	arginyltransferase 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100495601	ate1	arginyltransferase 1	8364	XB-GENE-961934	Inparanoid, OMA, EggNOG
C. elegans	172800	ate-1	Arginyl-tRNA--protein transferase 1	6239		OMA, EggNOG
Fruitfly	37288	Ate1	CG9204 gene product from transcript CG9204-RA	7227	FBgn0025720	Inparanoid, EggNOG
S.cerevisiae	852867	ATE1	arginyltransferase	4932	S000002985	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.