JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ACRV1

Description	Acrosomal protein SP-10

Gene and Protein Information

Gene ID	56
Uniprot Accession IDs	P26436 Q53FF4
Ensembl ID	ENSG00000134940
Symbol	SP-10 SPACA2 D11S4365
Chromosome	11
Sequence	MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	739927	ACRV1	acrosomal vesicle protein 1	9598	VGNC:3232	OMA, EggNOG
Macaque	713422	ACRV1	acrosomal vesicle protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	11451	Acrv1	acrosomal vesicle protein 1	10090	MGI:104590	Inparanoid, OMA, EggNOG
Rat	60353	Acrv1	acrosomal vesicle protein 1	10116	RGD:620153	Inparanoid, OMA, EggNOG
Dog	607249	ACRV1	acrosomal vesicle protein 1	9615	VGNC:37528	Inparanoid, OMA, EggNOG
Cow	529863	ACRV1	acrosomal vesicle protein 1	9913	VGNC:25559	Inparanoid, OMA, EggNOG
Pig	100359345	ACRV1	acrosomal vesicle protein 1	9823		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.