JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CLIC4

Description	Chloride intracellular channel protein 4

Gene and Protein Information

Gene ID	25932
Uniprot Accession IDs	Q9Y696 Q9UFW9 Q9UQJ6
Ensembl ID	ENSG00000169504
Symbol	H1 huH1 p64H1 CLIC4L MTCLIC
Chromosome	1
Family	Belongs to the chloride channel CLIC family.
Sequence	MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	749398	CLIC4	chloride intracellular channel 4	9598	VGNC:10579	OMA, EggNOG
Macaque	712337	CLIC4	chloride intracellular channel 4	9544		Inparanoid, OMA
Mouse	29876	Clic4	chloride intracellular channel 4 (mitochondrial)	10090	MGI:1352754	Inparanoid, OMA, EggNOG
Rat	83718	Clic4	chloride intracellular channel 4	10116	RGD:61857	Inparanoid, OMA, EggNOG
Dog	487367	CLIC4	chloride intracellular channel 4	9615	VGNC:39340	Inparanoid, OMA
Horse	100071457	CLIC4	chloride intracellular channel 4	9796	VGNC:16613	Inparanoid, OMA
Cow	286823	CLIC4	chloride intracellular channel 4	9913	VGNC:27442	Inparanoid, OMA
Opossum	100012549	CLIC4	chloride intracellular channel 4	13616		Inparanoid, OMA
Chicken	419595	CLIC4	chloride intracellular channel 4	9031	CGNC:861	Inparanoid, OMA
Anole lizard	100552159	clic4	chloride intracellular channel 4	28377		Inparanoid, OMA
Zebrafish	368255	clic4	chloride intracellular channel 4	7955	ZDB-GENE-030326-3	Inparanoid, OMA

DTO Classes
protein / Ion channel / Intracellular chloride channel (clic) family / Chloride intracellular channel protein 4

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.