JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CLIC3

Description	Chloride intracellular channel protein 3

Gene and Protein Information

Gene ID	9022
Uniprot Accession IDs	O95833 Q5SPZ7
Ensembl ID	ENSG00000169583
Chromosome	9
Family	Belongs to the chloride channel CLIC family.
Sequence	MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464921	CLIC3	chloride intracellular channel 3	9598	VGNC:13865	OMA, EggNOG
Macaque	721634	CLIC3	chloride intracellular channel 3	9544		Inparanoid, OMA
Mouse	69454	Clic3	chloride intracellular channel 3	10090	MGI:1916704	Inparanoid, OMA
Rat	296566	Clic3	chloride intracellular channel 3	10116	RGD:1307249	Inparanoid, OMA
Dog	607042	CLIC3	chloride intracellular channel 3	9615	VGNC:39339	Inparanoid, OMA, EggNOG
Horse	100066181	CLIC3	chloride intracellular channel 3	9796	VGNC:16612	Inparanoid, OMA
Cow	505436	CLIC3	chloride intracellular channel 3	9913	VGNC:27441	Inparanoid, OMA, EggNOG
Opossum	100022461	CLIC3	chloride intracellular channel 3	13616		Inparanoid, EggNOG
Platypus	100083829	CLIC3	chloride intracellular channel 3	9258		Inparanoid, OMA
Anole lizard	103281557	clic3	chloride intracellular channel 3	28377		Inparanoid, OMA
Xenopus	447989	clic3	chloride intracellular channel 3	8364	XB-GENE-959390	Inparanoid, OMA, EggNOG
Zebrafish	84040	clic3	chloride intracellular channel 3	7955	ZDB-GENE-010507-2	OMA, EggNOG

DTO Classes
protein / Ion channel / Intracellular chloride channel (clic) family / Chloride intracellular channel protein 3

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.