The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
ARF5
Description |
ADP-ribosylation factor 5
|
Gene and Protein Information
Gene ID |
381
|
Uniprot Accession IDs |
P84085
P26437
|
Ensembl ID |
ENSG00000004059
|
Chromosome |
7
|
Family |
Belongs to the small GTPase superfamily. Arf family. |
Sequence |
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
|
Homologous gene and protein info.
Associated Recombinant Proteins
Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.