JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CLTA

Description	Clathrin light chain A

Gene and Protein Information

Gene ID	1211
Uniprot Accession IDs	P09496 A8K4W3 B4DIN1 F5H6N3 Q2XPN5 Q53XZ1 Lca
Ensembl ID	ENSG00000122705
Symbol	LCA
Chromosome	9
Family	Belongs to the clathrin light chain family.
Sequence	MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	465093	CLTA	clathrin light chain A	9598	VGNC:8808	OMA, EggNOG
Macaque	693659	CLTA	clathrin light chain A	9544		Inparanoid, OMA, EggNOG
Mouse	12757	Clta	clathrin, light polypeptide (Lca)	10090	MGI:894297	Inparanoid, OMA, EggNOG
Rat	83800	Clta	clathrin, light chain A	10116	RGD:70919	Inparanoid, OMA, EggNOG
Dog	100856559	CLTA	clathrin light chain A	9615	VGNC:39365	Inparanoid, OMA, EggNOG
Horse	100055375	CLTA	clathrin light chain A	9796	VGNC:16640	Inparanoid, OMA, EggNOG
Cow	281078	CLTA	clathrin light chain A	9913	VGNC:27469	Inparanoid, OMA, EggNOG
Opossum	100013047	CLTA	clathrin light chain A	13616		Inparanoid, OMA, EggNOG
Platypus		CLTA	clathrin light chain A [Source:HGNC Symbol;Acc:HGNC:2090]	9258		OMA, EggNOG
Chicken	427284	CLTA	clathrin light chain A	9031	CGNC:53038	Inparanoid, OMA, EggNOG
Anole lizard	100558023	clta	clathrin light chain A	28377		Inparanoid, OMA, EggNOG
Xenopus	394591	clta	clathrin light chain A	8364	XB-GENE-944169	Inparanoid, OMA, EggNOG
Zebrafish	406318	clta	clathrin, light chain A	7955	ZDB-GENE-040426-1986	Inparanoid, OMA, EggNOG
C. elegans	179150	clic-1	Clathrin light chain	6239		OMA, EggNOG
Fruitfly	40221	Clc	Clathrin light chain	7227	FBgn0024814	Inparanoid, EggNOG

PANTHER Classes
protein / membrane traffic protein / vesicle coat protein / Clathrin light chain A

DTO Classes
protein / Transporter / Vesicle coat protein / Clathrin light chain A

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.