JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ARL8A

Description	ADP-ribosylation factor-like protein 8A

Gene and Protein Information

Gene ID	127829
Uniprot Accession IDs	Q96BM9 B3KXD0
Ensembl ID	ENSG00000143862
Symbol	ARL10B GIE2 GIE2 ARL10B
Chromosome	1
Family	Belongs to the small GTPase superfamily. Arf family.
Sequence	MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	68724	Arl8a	ADP-ribosylation factor-like 8A	10090	MGI:1915974	Inparanoid, OMA, EggNOG
Rat	498234	Arl8a	ADP-ribosylation factor like GTPase 8A	10116	RGD:1565940	Inparanoid, OMA, EggNOG
Chicken	421175	ARL8A	ADP ribosylation factor like GTPase 8A	9031	CGNC:375	Inparanoid, OMA
Anole lizard	100566871	arl8a	ADP ribosylation factor like GTPase 8A	28377		Inparanoid, OMA
Xenopus	394587	arl8a	ADP ribosylation factor like GTPase 8A	8364	XB-GENE-866659	Inparanoid, OMA
Zebrafish	567222	arl8a	ADP-ribosylation factor-like 8A	7955	ZDB-GENE-030131-5025	Inparanoid, OMA
C. elegans	178405	arl-8	ARF-Like	6239		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.