JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

APOC1

Description	Apolipoprotein C-I

Gene and Protein Information

Gene ID	341
Uniprot Accession IDs	P02654 B2R526 Q6IB97 Apo-CI
Ensembl ID	ENSG00000130208
Symbol	Apo-CI ApoC-I apo-CIB apoC-IB
Chromosome	19
Family	Belongs to the apolipoprotein C1 family.
Sequence	MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743864	APOC1	apolipoprotein C1	9598	VGNC:10193	Inparanoid, OMA
Mouse	11812	Apoc1	apolipoprotein C-I	10090	MGI:88053	Inparanoid, OMA
Dog	476437	APOC1	apolipoprotein C1	9615	VGNC:37999	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.