JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ATG10

Description	Ubiquitin-like-conjugating enzyme ATG10

Gene and Protein Information

Gene ID	83734
Uniprot Accession IDs	Q9H0Y0 B2RE09 Q6PIX1 Q9H842
Ensembl ID	ENSG00000152348
Symbol	APG10L APG10 APG10L pp12616
Chromosome	5
Family	Belongs to the ATG10 family.
Sequence	MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461768	ATG10	autophagy related 10	9598	VGNC:3907	OMA, EggNOG
Macaque	711835	ATG10	autophagy related 10	9544		Inparanoid, OMA, EggNOG
Mouse	66795	Atg10	autophagy related 10	10090	MGI:1914045	Inparanoid, OMA, EggNOG
Rat	688555	Atg10	autophagy related 10	10116	RGD:1587624	Inparanoid, OMA, EggNOG
Dog	610103	ATG10	autophagy related 10	9615	VGNC:38214	Inparanoid, OMA, EggNOG
Horse	100073249	ATG10	autophagy related 10	9796	VGNC:15615	Inparanoid, OMA, EggNOG
Cow	787344	ATG10	autophagy related 10	9913	VGNC:26248	OMA, EggNOG
Opossum	100015423	ATG10	autophagy related 10	13616		Inparanoid, OMA, EggNOG
Chicken	427322	ATG10	autophagy related 10	9031	CGNC:14227	Inparanoid, OMA
Zebrafish	641330	atg10	ATG10 autophagy related 10 homolog (S. cerevisiae)	7955	ZDB-GENE-051030-72	Inparanoid, OMA
C. elegans	183959	atg-10	AuTophaGy (yeast Atg homolog)	6239		Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.