JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TIA1

Description	Nucleolysin TIA-1 isoform p40

Gene and Protein Information

Gene ID	7072
Uniprot Accession IDs	P31483 Q53SS9 Q96B58
Ensembl ID	ENSG00000116001
Symbol	WDM TIA-1
Chromosome	2
Sequence	MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459303	TIA1	TIA1 cytotoxic granule associated RNA binding protein	9598		OMA, EggNOG
Macaque	702366	TIA1	TIA1 cytotoxic granule associated RNA binding protein	9544		Inparanoid, OMA, EggNOG
Mouse	21841	Tia1	cytotoxic granule-associated RNA binding protein 1	10090	MGI:107914	Inparanoid, OMA, EggNOG
Rat	312510	Tia1	TIA1 cytotoxic granule-associated RNA binding protein	10116	RGD:1305742	Inparanoid, OMA
Dog	610625	TIA1	TIA1 cytotoxic granule associated RNA binding protein	9615	VGNC:47363	Inparanoid, OMA, EggNOG
Horse		TIA1	TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802]	9796		OMA, EggNOG
Cow	538533	TIA1	TIA1 cytotoxic granule associated RNA binding protein	9913	VGNC:35858	Inparanoid, OMA, EggNOG
Opossum	100032808	TIA1	TIA1 cytotoxic granule associated RNA binding protein	13616		Inparanoid, EggNOG
Chicken	771327	TIA1	TIA1 cytotoxic granule associated RNA binding protein	9031		Inparanoid, OMA, EggNOG
Xenopus	394890	tia1	TIA1 cytotoxic granule-associated RNA binding protein	8364	XB-GENE-1002876	Inparanoid, OMA, EggNOG
Zebrafish	793165	tia1	TIA1 cytotoxic granule-associated RNA binding protein	7955	ZDB-GENE-030131-1506	Inparanoid, OMA, EggNOG
C. elegans	173967	tiar-1	TIA-1/TIAL RNA binding protein homolog	6239		OMA, EggNOG
S.cerevisiae	855716	PUB1	Pub1p	4932	S000004961	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.