JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

XPNPEP2

Description	Xaa-Pro aminopeptidase 2

Gene and Protein Information

Gene ID	7512
Uniprot Accession IDs	O43895 A0AV16 O75994
Ensembl ID	ENSG00000122121
Symbol	APP2 AEACEI
Chromosome	X
Family	Belongs to the peptidase M24B family.
Sequence	MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	465852	XPNPEP2	X-prolyl aminopeptidase 2	9598	VGNC:14724	OMA, EggNOG
Macaque	701972	XPNPEP2	X-prolyl aminopeptidase 2	9544		Inparanoid, OMA, EggNOG
Mouse	170745	Xpnpep2	X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound	10090	MGI:2180001	Inparanoid, OMA, EggNOG
Rat	117522	Xpnpep2	X-prolyl aminopeptidase 2	10116	RGD:621277	Inparanoid, OMA, EggNOG
Dog	492124	XPNPEP2	X-prolyl aminopeptidase 2	9615	VGNC:48458	Inparanoid, OMA, EggNOG
Horse	100059029	XPNPEP2	X-prolyl aminopeptidase 2	9796	VGNC:25073	Inparanoid, OMA, EggNOG
Cow	504822	XPNPEP2	X-prolyl aminopeptidase 2	9913	VGNC:36995	Inparanoid, OMA, EggNOG
Pig	445538	XPNPEP2	X-prolyl aminopeptidase 2	9823		Inparanoid, OMA, EggNOG
Opossum	100021640	XPNPEP2	X-prolyl aminopeptidase 2	13616		Inparanoid, OMA, EggNOG
Anole lizard	100563559	xpnpep2	X-prolyl aminopeptidase 2	28377		Inparanoid, OMA, EggNOG
Xenopus	100145559	xpnpep2	X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound	8364	XB-GENE-969249	Inparanoid, OMA, EggNOG
Zebrafish	394007	xpnpep2	X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound	7955	ZDB-GENE-040426-1151	Inparanoid, OMA, EggNOG
S.cerevisiae	850630	FRA1	Fra1p	4932	S000003952	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.