JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

STMN1

Description	Stathmin

Gene and Protein Information

Gene ID	3925
Uniprot Accession IDs	P16949 A2A2D1 B2R4E7 B7Z8N4 D3DPJ5
Ensembl ID	ENSG00000117632
Symbol	C1orf215 LAP18 OP18 Lag SMN OP18 PP17 PP19 PR22 LAP18 C1orf215
Chromosome	1
Family	Belongs to the stathmin family.
Sequence	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	456650	STMN1	stathmin 1	9598	VGNC:53215	Inparanoid, OMA, EggNOG
Macaque	719733	STMN1	stathmin 1	9544		Inparanoid, OMA
Mouse	16765	Stmn1	stathmin 1	10090	MGI:96739	Inparanoid, OMA
Rat	29332	Stmn1	stathmin 1	10116	RGD:2992	Inparanoid, OMA
Dog	478175	STMN1	stathmin 1	9615	VGNC:46925	Inparanoid, OMA
Horse	100057411	STMN1	stathmin 1	9796	VGNC:23698	Inparanoid, OMA
Cow	616317	STMN1	stathmin 1	9913		Inparanoid, OMA
Pig	494463	STMN1	stathmin 1	9823		Inparanoid, OMA
Opossum	100011564	STMN1	stathmin 1	13616		Inparanoid, OMA
Platypus	100083723	STMN1	stathmin 1	9258		Inparanoid, OMA
Chicken	396057	STMN1	stathmin 1	9031	CGNC:49630	Inparanoid, OMA
Anole lizard	100568004	stmn1	stathmin 1	28377		Inparanoid, OMA
Zebrafish	678630	stmn1a	stathmin 1a	7955	ZDB-GENE-031006-14	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.