This is a demo store. No orders will be fulfilled.
| Description | Taste receptor type 2 member 60 |
|---|
Gene and Protein Information
| Gene ID | 338398 |
|---|---|
| Uniprot Accession IDs | P59551 A4D2G8 Q645W8 Q7RTR7 T2R60 |
| Ensembl ID | ENSG00000185899 |
| Symbol | T2R56 T2R60 |
| Chromosome | 7 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence |
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSNCRLRAVLKSRRSSRCGTP
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493890 | TAS2R60 | taste 2 receptor member 60 | 9598 | VGNC:8777 | Inparanoid, OMA, EggNOG |
| Mouse | 387512 | Tas2r135 | taste receptor, type 2, member 135 | 10090 | MGI:2681302 | Inparanoid, OMA, EggNOG |
| Rat | 502757 | Tas2r135 | taste receptor, type 2, member 135 | 10116 | RGD:1561078 | Inparanoid, OMA, EggNOG |
| Pig | 100524179 | TAS2R60 | taste 2 receptor member 60 | 9823 | OMA, EggNOG | |
| Opossum | 664662 | TAS2R60 | taste 2 receptor member 60 | 13616 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 60
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 60
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later