This is a demo store. No orders will be fulfilled.

ORM1

Description Alpha-1-acid glycoprotein 1

Gene and Protein Information

Gene ID 5004
Uniprot Accession IDs P02763 B7ZKQ5 Q5T539 Q5U067 Q8TC16 AGP 1
Ensembl ID ENSG00000229314
Symbol AGP1 ORM AGP1 AGP-A HEL-S-153w
Chromosome 9
Family Belongs to the calycin superfamily. Lipocalin family.
Sequence
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Horse 100050100 LOC100050100 alpha-1-acid glycoprotein 2-like 9796 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.