JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

HLA-DRB1

Description	HLA class II histocompatibility antigen, DRB1-1 beta chain

Gene and Protein Information

Gene ID	3123
Uniprot Accession IDs	P04229 A4F5N0 A8K098 O62869 P13758 Q06662 Q30116 Q30117 Q5Y7E9 Q7M2H4 Q95461 Q9BCL7 Q9GIK5 Q9MXZ0 Q9MXZ5 Q9TQ91
Ensembl ID	ENSG00000196126
Symbol	SS1 DRB1 HLA-DRB HLA-DR1B
Chromosome	6
Family	Belongs to the MHC class II family.
Sequence	MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	14969	H2-Eb1	histocompatibility 2, class II antigen E beta	10090	MGI:95901	OMA, EggNOG
Rat	294270	RT1-Db1	RT1 class II, locus Db1	10116	RGD:1593282	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.