JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PRNP

Description	Alternative prion protein

Gene and Protein Information

Gene ID	5621
Uniprot Accession IDs	F7VJQ1
Ensembl ID	ENSG00000171867
Symbol	ALTPRP PRIP PRP CJD GSS PrP ASCR KURU PRIP PrPc CD230 AltPrP p27-30 PrP27-30 PrP33-35C
Chromosome	20
Sequence	MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVEQAE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	717859	PRNP	prion protein	9544		Inparanoid, OMA, EggNOG
Mouse	19122	Prnp	prion protein	10090	MGI:97769	Inparanoid, OMA, EggNOG
Rat	24686	Prnp	prion protein	10116	RGD:3410	Inparanoid, OMA, EggNOG
Dog	485783	PRNP	prion protein	9615	VGNC:45004	Inparanoid, OMA, EggNOG
Horse	100065904	PRNP	prion protein	9796	VGNC:21868	Inparanoid, OMA, EggNOG
Cow	281427	PRNP	prion protein	9913	VGNC:33356	Inparanoid, OMA, EggNOG
Pig	494014	PRNP	prion protein	9823		Inparanoid, OMA, EggNOG
Anole lizard	100555750	LOC100555750	major prion protein homolog	28377		OMA, EggNOG
Xenopus	100158502	prnp	prion protein	8364	XB-GENE-952814	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.