JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PI3

Description	Elafin

Gene and Protein Information

Gene ID	5266
Uniprot Accession IDs	P19957 E1P618 Q6FG74
Ensembl ID	ENSG00000124102
Symbol	WAP3 WFDC14 ESI WAP3 SKALP WFDC14 cementoin
Chromosome	20
Sequence	MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458276	PI3	peptidase inhibitor 3	9598	VGNC:6240	Inparanoid, OMA, EggNOG
Dog	477241	PI3	peptidase inhibitor 3	9615	VGNC:44516	Inparanoid, OMA, EggNOG
Horse	100056125	PI3	peptidase inhibitor 3	9796	VGNC:21408	Inparanoid, OMA, EggNOG
Cow	407163	LOC407163	trappin 5	9913		OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / serine protease inhibitor / Elafin

DTO Classes
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / Elafin

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.