JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GFER

Description	FAD-linked sulfhydryl oxidase ALR

Gene and Protein Information

Gene ID	2671
Uniprot Accession IDs	P55789 Q53YM6 Q8TAH6 Q9H290 Q9UK40
Ensembl ID	ENSG00000127554
Symbol	ALR HERV1 HPO ALR HPO HSS ERV1 HPO1 HPO2 HERV1
Chromosome	16
Sequence	MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	694203	GFER	growth factor, augmenter of liver regeneration	9544		Inparanoid, EggNOG
Mouse	11692	Gfer	growth factor, augmenter of liver regeneration	10090	MGI:107757	Inparanoid, OMA, EggNOG
Rat	27100	Gfer	growth factor, augmenter of liver regeneration	10116	RGD:61845	Inparanoid, OMA, EggNOG
Dog	479885	GFER	growth factor, augmenter of liver regeneration	9615		Inparanoid, EggNOG
Horse	100065617	GFER	growth factor, augmenter of liver regeneration	9796	VGNC:18311	Inparanoid, OMA, EggNOG
Cow	618423	GFER	growth factor, augmenter of liver regeneration	9913	VGNC:29324	Inparanoid, OMA, EggNOG
Pig	100515774	GFER	growth factor, augmenter of liver regeneration	9823		OMA, EggNOG
Opossum		GFER	growth factor, augmenter of liver regeneration [Source:HGNC Symbol;Acc:HGNC:4236]	13616		Inparanoid, OMA, EggNOG
Chicken	416547	GFER	growth factor, augmenter of liver regeneration	9031	CGNC:4155	Inparanoid, OMA, EggNOG
Anole lizard	100551634	gfer	growth factor, augmenter of liver regeneration	28377		Inparanoid, OMA, EggNOG
Xenopus	100488306	gfer	growth factor, augmenter of liver regeneration	8364	XB-GENE-987617	Inparanoid, OMA, EggNOG
Zebrafish	560433	gfer	growth factor, augmenter of liver regeneration (ERV1 homolog, S. cerevisiae)	7955	ZDB-GENE-060810-186	Inparanoid, OMA, EggNOG
C. elegans	171611	F56C11.3	Sulfhydryl oxidase	6239		OMA, EggNOG
Fruitfly	32991	Alr	Augmenter of liver regeneration	7227	FBgn0031068	Inparanoid, EggNOG
S.cerevisiae	852916	ERV1	flavin-linked sulfhydryl oxidase	4932	S000003261	Inparanoid, EggNOG

PANTHER Classes
protein / oxidoreductase / oxidase / FAD-linked sulfhydryl oxidase ALR

DTO Classes
protein / Enzyme / Oxidoreductase / Oxidase / FAD-linked sulfhydryl oxidase ALR

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.