JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ADORA2B

Description	Adenosine receptor A2b

Gene and Protein Information

Gene ID	136
Uniprot Accession IDs	P29275
Ensembl ID	ENSG00000170425
Symbol	ADORA2
Chromosome	17
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	455009	ADORA2B	adenosine A2b receptor	9598	VGNC:9120	OMA, EggNOG
Mouse	11541	Adora2b	adenosine A2b receptor	10090	MGI:99403	Inparanoid, OMA, EggNOG
Rat	29316	Adora2b	adenosine A2B receptor	10116	RGD:2050	Inparanoid, OMA, EggNOG
Dog	403410	ADORA2B	adenosine A2b receptor	9615	VGNC:37667	Inparanoid, OMA, EggNOG
Horse	100063319	ADORA2B	adenosine A2b receptor	9796	VGNC:15127	Inparanoid, OMA, EggNOG
Cow	529760	ADORA2B	adenosine A2b receptor	9913	VGNC:25688	Inparanoid, OMA, EggNOG
Opossum		ADORA2B	adenosine A2b receptor [Source:HGNC Symbol;Acc:HGNC:264]	13616		Inparanoid, OMA, EggNOG
Chicken	395971	ADORA2B	adenosine A2b receptor	9031	CGNC:49582	Inparanoid, OMA
Zebrafish	560100	adora2b	adenosine A2b receptor	7955	ZDB-GENE-060511-1	Inparanoid, OMA

PANTHER Classes
protein / receptor / G-protein coupled receptor / Adenosine receptor a2b

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a2b

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.