The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
ANXA5
Gene and Protein Information
| Gene ID |
308
|
| Uniprot Accession IDs |
P08758
D3DNW7
Q6FHB3
Q6FI16
Q8WV69
Q9UDH9
|
| Ensembl ID |
ENSG00000164111
|
| Symbol |
ANX5
ENX2
PP4
PP4
ANX5
ENX2
RPRGL3
HEL-S-7
|
| Chromosome |
4
|
| Family |
Belongs to the annexin family. |
| Sequence |
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
461466 |
ANXA5 |
annexin A5 |
9598 |
VGNC:565 |
Inparanoid, OMA, EggNOG |
| Macaque |
706941 |
ANXA5 |
annexin A5 |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
11747 |
Anxa5 |
annexin A5 |
10090 |
MGI:106008 |
Inparanoid, OMA, EggNOG |
| Rat |
25673 |
Anxa5 |
annexin A5 |
10116 |
RGD:2120 |
Inparanoid, OMA, EggNOG |
| Dog |
476094 |
ANXA5 |
annexin A5 |
9615 |
VGNC:37942 |
Inparanoid, OMA, EggNOG |
| Horse |
100072241 |
ANXA5 |
annexin A5 |
9796 |
VGNC:15364 |
Inparanoid, OMA, EggNOG |
| Cow |
281626 |
ANXA5 |
annexin A5 |
9913 |
VGNC:25967 |
Inparanoid, OMA, EggNOG |
| Pig |
100521982 |
ANXA5 |
annexin A5 |
9823 |
|
OMA, EggNOG |
| Opossum |
100017420 |
ANXA5 |
annexin A5 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Platypus |
100081552 |
ANXA5 |
annexin A5 |
9258 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
428767 |
ANXA5 |
annexin A5 |
9031 |
CGNC:9009 |
Inparanoid, OMA |
| Anole lizard |
100565969 |
anxa5 |
annexin A5 |
28377 |
|
Inparanoid, OMA, EggNOG |
| Xenopus |
493545 |
anxa5 |
annexin A5 |
8364 |
XB-GENE-1007295 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
337132 |
anxa5b |
annexin A5b |
7955 |
ZDB-GENE-030131-9076 |
Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.