This is a demo store. No orders will be fulfilled.

ACVR1

Description Activin receptor type-1

Gene and Protein Information

Gene ID 90
Uniprot Accession IDs Q04771
Ensembl ID ENSG00000115170
Symbol ACVRLK2 FOP ALK2 SKR1 TSRI ACTRI ACVR1A ACVRLK2
Chromosome 2
Family Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
Sequence
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 470565 ACVR1 activin A receptor type 1 9598 VGNC:56 OMA, EggNOG
Macaque 697935 ACVR1 activin A receptor type 1 9544 Inparanoid, OMA, EggNOG
Mouse 11477 Acvr1 activin A receptor, type 1 10090 MGI:87911 Inparanoid, OMA, EggNOG
Rat 79558 Acvr1 activin A receptor type 1 10116 RGD:620200 Inparanoid, OMA, EggNOG
Dog 478757 ACVR1 activin A receptor type 1 9615 VGNC:37561 Inparanoid, OMA
Horse 100050899 ACVR1 activin A receptor type 1 9796 VGNC:15035 Inparanoid, OMA
Cow 338068 ACVR1 activin A receptor type 1 9913 VGNC:25592 Inparanoid, OMA
Pig 100152307 ACVR1 activin A receptor type 1 9823 Inparanoid, OMA
Opossum 100021438 ACVR1 activin A receptor type 1 13616 Inparanoid, OMA
Anole lizard 100552279 acvr1 activin A receptor type 1 28377 Inparanoid, OMA
Xenopus 550111 acvr1 activin A receptor type 1 8364 XB-GENE-478850 Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    protein kinase receptor    /    Activin receptor type-1
protein    /    receptor    /    TGF-beta receptor    /    Activin receptor type-1
protein    /    receptor    /    serine/threonine protein kinase receptor    /    Activin receptor type-1
protein    /    receptor    /    protein kinase    /    Activin receptor type-1
protein    /    receptor    /    transferase    /    Activin receptor type-1
protein    /    receptor    /    kinase    /    Activin receptor type-1
DTO Classes
protein    /    Kinase    /    Protein kinase    /    TKL group    /    STKR family    /    STKR Type 1 subfamily    /    Activin receptor type-1

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.