This is a demo store. No orders will be fulfilled.

VAMP2

Description Vesicle-associated membrane protein 2

Gene and Protein Information

Gene ID 6844
Uniprot Accession IDs P63027 P19065 Q9BUC2 VAMP-2
Ensembl ID ENSG00000220205
Symbol SYB2 SYB2 VAMP-2
Chromosome 17
Family Belongs to the synaptobrevin family.
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Macaque 574134 VAMP2 vesicle associated membrane protein 2 9544 Inparanoid, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.