JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ATP6V1E1

Description	V-type proton ATPase subunit E 1

Gene and Protein Information

Gene ID	529
Uniprot Accession IDs	P36543 A8MUE4 A8MUN4 V-ATPase subunit E 1
Ensembl ID	ENSG00000131100
Symbol	ATP6E ATP6E2 P31 Vma4 ATP6E ARCL2C ATP6E2 ATP6V1E
Chromosome	22
Family	Belongs to the V-ATPase E subunit family.
Sequence	MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	709739	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9544		OMA, EggNOG
Mouse	11973	Atp6v1e1	ATPase, H+ transporting, lysosomal V1 subunit E1	10090	MGI:894326	Inparanoid, OMA
Rat	297566	Atp6v1e1	ATPase H+ transporting V1 subunit E1	10116	RGD:735157	Inparanoid, OMA
Dog	477740	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9615		Inparanoid, OMA
Horse	100049854	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9796	VGNC:15681	Inparanoid, OMA
Cow	287017	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9913	VGNC:26322	Inparanoid, OMA, EggNOG
Pig	100156112	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9823		Inparanoid, OMA
Chicken	418162	ATP6V1E1	ATPase H+ transporting V1 subunit E1	9031	CGNC:50685	Inparanoid, OMA, EggNOG
Anole lizard	100563341	atp6v1e1	ATPase H+ transporting V1 subunit E1	28377		OMA, EggNOG
Xenopus	394728	atp6v1e1	ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1	8364	XB-GENE-1006142	OMA, EggNOG
Zebrafish	192335	atp6v1e1b	ATPase H+ transporting V1 subunit E1b	7955	ZDB-GENE-020419-11	OMA, EggNOG
Zebrafish	108179059	atp6v1e1a	ATPase H+ transporting V1 subunit E1a	7955	ZDB-GENE-041212-51	Inparanoid, OMA
S.cerevisiae	854509	VMA4	H(+)-transporting V1 sector ATPase subunit E	4932	S000005859	OMA, EggNOG

DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit E 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.