JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

UBE2T

Description	Ubiquitin-conjugating enzyme E2 T

Gene and Protein Information

Gene ID	29089
Uniprot Accession IDs	Q9NPD8 Q2TU36
Ensembl ID	ENSG00000077152
Symbol	FANCT PIG50 HSPC150
Chromosome	1
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457628	UBE2T	ubiquitin conjugating enzyme E2 T	9598	VGNC:7020	OMA, EggNOG
Macaque	705911	UBE2T	ubiquitin conjugating enzyme E2 T	9544		OMA, EggNOG
Mouse	67196	Ube2t	ubiquitin-conjugating enzyme E2T	10090	MGI:1914446	Inparanoid, OMA, EggNOG
Rat	360847	Ube2t	ubiquitin-conjugating enzyme E2T	10116	RGD:1310816	Inparanoid, OMA, EggNOG
Dog	607154	UBE2T	ubiquitin conjugating enzyme E2 T	9615	VGNC:48066	Inparanoid, OMA, EggNOG
Horse		UBE2T	ubiquitin conjugating enzyme E2 T [Source:HGNC Symbol;Acc:HGNC:25009]	9796		OMA, EggNOG
Cow	505314	UBE2T	ubiquitin conjugating enzyme E2 T	9913	VGNC:36596	Inparanoid, OMA, EggNOG
Chicken	421149	UBE2T	ubiquitin conjugating enzyme E2 T	9031	CGNC:48	Inparanoid, OMA, EggNOG
Zebrafish	768152	ube2t	ubiquitin-conjugating enzyme E2T (putative)	7955	ZDB-GENE-061013-547	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.