JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ZNHIT1

Description	Zinc finger HIT domain-containing protein 1

Gene and Protein Information

Gene ID	10467
Uniprot Accession IDs	O43257 Q6IB12
Ensembl ID	ENSG00000106400
Symbol	CGBP1 ZNFN4A1 CG1I ZNFN4A1
Chromosome	7
Family	Belongs to the ZNHIT1 family.
Sequence	MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472469	ZNHIT1	zinc finger HIT-type containing 1	9598	VGNC:4589	OMA, EggNOG
Macaque	714339	ZNHIT1	zinc finger HIT-type containing 1	9544		Inparanoid, OMA, EggNOG
Mouse	70103	Znhit1	zinc finger, HIT domain containing 1	10090	MGI:1917353	Inparanoid, OMA, EggNOG
Rat	100360077	Znhit1	zinc finger, HIT-type containing 1	10116	RGD:2322870	Inparanoid, OMA, EggNOG
Dog	479729	ZNHIT1	zinc finger HIT-type containing 1	9615	VGNC:48835	Inparanoid, OMA, EggNOG
Horse	100059516	ZNHIT1	zinc finger HIT-type containing 1	9796	VGNC:25399	Inparanoid, OMA, EggNOG
Cow	514997	ZNHIT1	zinc finger HIT-type containing 1	9913	VGNC:37358	Inparanoid, OMA, EggNOG
Opossum	100016770	ZNHIT1	zinc finger HIT-type containing 1	13616		Inparanoid, OMA, EggNOG
Xenopus	549810	znhit1	zinc finger, HIT-type containing 1	8364	XB-GENE-5848028	Inparanoid, OMA, EggNOG
Zebrafish	407699	znhit1	zinc finger, HIT-type containing 1	7955	ZDB-GENE-050417-272	Inparanoid, OMA, EggNOG
C. elegans	183878	zhit-1	Zinc finger, HIT-type	6239		Inparanoid, OMA, EggNOG
Fruitfly	326171	CG31917	CG31917 gene product from transcript CG31917-RA	7227	FBgn0031668	Inparanoid, EggNOG

PANTHER Classes
protein / transcription factor / zinc finger transcription factor / Zinc finger HIT domain-containing protein 1

DTO Classes
protein / Transcription factor / Zinc finger transcription factor / Zinc finger HIT domain-containing protein 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.