JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ZNRF2

Description	E3 ubiquitin-protein ligase ZNRF2

Gene and Protein Information

Gene ID	223082
Uniprot Accession IDs	Q8NHG8
Ensembl ID	ENSG00000180233
Symbol	RNF202 RNF202
Chromosome	7
Sequence	MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	463326	ZNRF2	zinc and ring finger 2	9598	VGNC:14124	OMA, EggNOG
Macaque	698413	ZNRF2	zinc and ring finger 2	9544		OMA, EggNOG
Mouse	387524	Znrf2	zinc and ring finger 2	10090	MGI:1196246	Inparanoid, OMA, EggNOG
Rat	362367	Znrf2	zinc and ring finger 2	10116	RGD:1306645	Inparanoid, OMA, EggNOG
Cow	615645	ZNRF2	zinc and ring finger 2	9913	VGNC:37364	Inparanoid, OMA, EggNOG
Opossum	100032540	ZNRF2	zinc and ring finger 2	13616		Inparanoid, OMA, EggNOG
Anole lizard	100558877	znrf2	zinc and ring finger 2	28377		Inparanoid, OMA
Zebrafish	767761	znrf2b	zinc and ring finger 2b	7955	ZDB-GENE-060929-24	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.