This is a demo store. No orders will be fulfilled.

UBE2Z

Description Ubiquitin-conjugating enzyme E2 Z

Gene and Protein Information

Gene ID 65264
Uniprot Accession IDs Q9H832 A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893
Ensembl ID ENSG00000159202
Symbol USE1 HOYS7
Chromosome 17
Family Belongs to the ubiquitin-conjugating enzyme family.
Sequence
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 455196 UBE2Z ubiquitin conjugating enzyme E2 Z 9598 VGNC:9762 OMA, EggNOG
Mouse 268470 Ube2z ubiquitin-conjugating enzyme E2Z 10090 MGI:1343160 Inparanoid, OMA, EggNOG
Rat 303478 Ube2z ubiquitin-conjugating enzyme E2Z 10116 RGD:1308347 Inparanoid, OMA, EggNOG
Dog 491062 UBE2Z ubiquitin conjugating enzyme E2 Z 9615 VGNC:48067 Inparanoid, OMA
Horse 100069535 UBE2Z ubiquitin conjugating enzyme E2 Z 9796 VGNC:24729 Inparanoid, OMA, EggNOG
Cow 100138178 UBE2Z ubiquitin conjugating enzyme E2 Z 9913 VGNC:36598 Inparanoid, OMA, EggNOG
Pig 100523993 UBE2Z ubiquitin conjugating enzyme E2 Z 9823 OMA, EggNOG
Opossum 100021140 UBE2Z ubiquitin conjugating enzyme E2 Z 13616 Inparanoid, OMA
Chicken 419991 UBE2Z ubiquitin conjugating enzyme E2 Z 9031 CGNC:899 Inparanoid, OMA
Anole lizard 100552398 ube2z ubiquitin conjugating enzyme E2 Z 28377 Inparanoid, OMA
Xenopus 493338 ube2z ubiquitin conjugating enzyme E2Z 8364 XB-GENE-990986 Inparanoid, OMA
Zebrafish 436602 ube2z ubiquitin-conjugating enzyme E2Z 7955 ZDB-GENE-040718-15 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.