The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
AVPR2
| Description |
Vasopressin V2 receptor
|
Gene and Protein Information
| Gene ID |
554
|
| Uniprot Accession IDs |
P30518
C5HF20
O43192
Q3MJD3
Q9UCV9
V2R
|
| Ensembl ID |
ENSG00000126895
|
| Symbol |
ADHR
DIR
DIR3
V2R
DI1
DIR
NDI
V2R
ADHR
DIR3
|
| Chromosome |
X
|
| Family |
Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. |
| Sequence |
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
742565 |
AVPR2 |
arginine vasopressin receptor 2 |
9598 |
VGNC:1407 |
OMA, EggNOG |
| Mouse |
12000 |
Avpr2 |
arginine vasopressin receptor 2 |
10090 |
MGI:88123 |
Inparanoid, OMA |
| Rat |
25108 |
Avpr2 |
arginine vasopressin receptor 2 |
10116 |
RGD:2186 |
Inparanoid, OMA |
| Dog |
403804 |
AVPR2 |
arginine vasopressin receptor 2 |
9615 |
VGNC:38320 |
Inparanoid, OMA |
| Horse |
100059066 |
AVPR2 |
arginine vasopressin receptor 2 |
9796 |
VGNC:15712 |
Inparanoid, OMA |
| Cow |
281642 |
AVPR2 |
arginine vasopressin receptor 2 |
9913 |
VGNC:26360 |
Inparanoid, OMA |
| Pig |
397462 |
AVPR2 |
arginine vasopressin receptor 2 |
9823 |
|
Inparanoid, OMA |
| Platypus |
100091389 |
AVPR2 |
arginine vasopressin receptor 2 |
9258 |
|
Inparanoid, OMA |
| Anole lizard |
100562801 |
avpr2 |
arginine vasopressin receptor 2 |
28377 |
|
Inparanoid, OMA |
| Xenopus |
100487051 |
avpr2 |
arginine vasopressin receptor 2 (nephrogenic diabetes insipidus) |
8364 |
XB-GENE-482287 |
Inparanoid, OMA |
| Zebrafish |
100007585 |
avpr2aa |
arginine vasopressin receptor 2a, duplicate a |
7955 |
ZDB-GENE-090313-344 |
Inparanoid, OMA |
| C. elegans |
184471 |
ntr-2 |
Nematocin receptor 2 |
6239 |
|
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.