JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

COMT

Description	Catechol O-methyltransferase

Gene and Protein Information

Gene ID	1312
Uniprot Accession IDs	P21964 A8MPV9 Q6IB07 Q6ICE6 Q9BWC7
Ensembl ID	ENSG00000093010
Symbol	HEL-S-98n
Chromosome	22
Family	Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family.
Sequence	MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458655	COMT	catechol-O-methyltransferase	9598	VGNC:12831	OMA, EggNOG
Mouse	12846	Comt	catechol-O-methyltransferase	10090	MGI:88470	Inparanoid, OMA, EggNOG
Rat	24267	Comt	catechol-O-methyltransferase	10116	RGD:2379	Inparanoid, OMA, EggNOG
Dog	445450	COMT	catechol-O-methyltransferase	9615	VGNC:39501	Inparanoid, OMA, EggNOG
Pig	100155530	COMT	catechol-O-methyltransferase	9823		Inparanoid, OMA, EggNOG
Chicken	416783	MIR4761	microRNA 4761	9031	CGNC:1439	OMA, EggNOG
Xenopus	100135405	LOC100135405	uncharacterized LOC100135405	8364		Inparanoid, OMA
Xenopus	549111	comt	catechol-O-methyltransferase	8364	XB-GENE-948947	OMA, EggNOG
Zebrafish	561372	comta	catechol-O-methyltransferase a	7955	ZDB-GENE-050913-117	OMA, EggNOG
Zebrafish	565370	comtb	catechol-O-methyltransferase b	7955	ZDB-GENE-040724-164	Inparanoid, OMA

PANTHER Classes
protein / transferase / methyltransferase / Catechol O-methyltransferase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Catechol O-methyltransferase

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.