JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

COX11

Description	Cytochrome c oxidase assembly protein COX11, mitochondrial

Gene and Protein Information

Gene ID	1353
Uniprot Accession IDs	Q9Y6N1 D3DTY5 I3L220 Q6FHB7 Q9BRX0 Q9UME8
Ensembl ID	ENSG00000166260
Symbol	COX11P
Chromosome	17
Family	Belongs to the COX11/CtaG family.
Sequence	MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748332	COX11	COX11, cytochrome c oxidase copper chaperone	9598	VGNC:12146	OMA, EggNOG
Macaque	641445	COX11	COX11 homolog, cytochrome c oxidase assembly protein	9544		Inparanoid, OMA, EggNOG
Mouse	69802	Cox11	cytochrome c oxidase assembly protein 11	10090	MGI:1917052	Inparanoid, OMA, EggNOG
Dog	609555	COX11	COX11 cytochrome c oxidase assembly homolog (yeast)	9615		Inparanoid, OMA, EggNOG
Horse	100056543	COX11	COX11, cytochrome c oxidase copper chaperone	9796	VGNC:51473	Inparanoid, OMA, EggNOG
Cow	510509	COX11	COX11 cytochrome c oxidase assembly homolog (yeast)	9913		Inparanoid, OMA, EggNOG
Opossum	100014890	LOC100014890	cytochrome c oxidase assembly protein COX11, mitochondrial	13616		OMA, EggNOG
Chicken	770638	COX11	COX11, cytochrome c oxidase copper chaperone	9031	CGNC:66650	Inparanoid, OMA
Anole lizard	100566567	LOC100566567	cytochrome c oxidase assembly protein COX11, mitochondrial	28377		OMA, EggNOG
Xenopus		cox11	COX11 cytochrome c oxidase copper chaperone [Source:Xenbase;Acc:XB-GENE-6048797]	8364		OMA, EggNOG
Zebrafish	100005158	cox11	cytochrome c oxidase assembly homolog 11 (yeast)	7955	ZDB-GENE-050506-82	Inparanoid, OMA, EggNOG
C. elegans	186814	cox-11	Cytochrome OXidase assembly protein	6239		Inparanoid, OMA
Fruitfly	33776	CG31648	CG31648 gene product from transcript CG31648-RA	7227	FBgn0051648	Inparanoid, EggNOG
S.cerevisiae	855971	COX11	Cox11p	4932	S000006053	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.