JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

BCL2L12

Description	Bcl-2-like protein 12

Gene and Protein Information

Gene ID	83596
Uniprot Accession IDs	Q9HB09 Q3SY11 Q3SY13 Q96I96 Q9HB08 Bcl2-L-12
Ensembl ID	ENSG00000126453
Symbol	BPR
Chromosome	19
Family	Belongs to the Bcl-2 family.
Sequence	MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	456213	BCL2L12	BCL2 like 12	9598	VGNC:6615	OMA, EggNOG
Macaque	718981	BCL2L12	BCL2 like 12	9544		OMA, EggNOG
Mouse	75736	Bcl2l12	BCL2-like 12 (proline rich)	10090	MGI:1922986	Inparanoid, OMA, EggNOG
Rat	361567	Bcl2l12	BCL2 like 12	10116	RGD:1307361	Inparanoid, OMA, EggNOG
Dog	100688537	BCL2L12	BCL2 like 12	9615	VGNC:53525	Inparanoid, OMA, EggNOG
Horse	100055909	BCL2L12	BCL2 like 12	9796	VGNC:15792	Inparanoid, OMA, EggNOG
Cow	533338	BCL2L12	BCL2 like 12	9913	VGNC:26447	Inparanoid, OMA, EggNOG
Pig	100521559	BCL2L12	BCL2 like 12	9823		OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.